PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.20992s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 593aa    MW: 66235.2 Da    PI: 6.2717
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.20992s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.39.8e-2967151187
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                           rW++qe+laL+++r++m+ ++r+++ k+plWeevs+km+e g+ r++k+Ckek+en+ k++k++keg+ +++  + +t+++fdqlea
  Cagra.20992s0002.1.p  67 RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKYHKRTKEGRTGKS--DGKTYRFFDQLEA 151
                           8********************************************************************964..5557*******85 PP

2trihelix105.34.4e-33390475187
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                           rW+k e+ aLi++r++++++++++  k+plWee+s+ mr+ gf+r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Cagra.20992s0002.1.p 390 RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 475
                           8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.1264126IPR001005SANT/Myb domain
PfamPF138375.6E-1866152No hitNo description
PROSITE profilePS500906.95766124IPR017877Myb-like domain
CDDcd122034.96E-2266131No hitNo description
PROSITE profilePS500907.271383447IPR017877Myb-like domain
SMARTSM007170.0017387449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-4388446IPR009057Homeodomain-like
PfamPF138373.3E-22389476No hitNo description
CDDcd122031.16E-26390454No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MMQLGGGTPT TATTTAASTA TTTAPPPPPP PPAQSNDSAA TEAAAAAAVG AFEVSEEMNE  60
RGFGGNRWPR QETLALLKIR SDMGIAFRDA SVKGPLWEEV SRKMAELGYI RNAKKCKEKF  120
ENVYKYHKRT KEGRTGKSDG KTYRFFDQLE ALETQSTTSH HHHHNNNNNS SIFSTPPPVT  180
TVLPSVATLP SSSIPPYTLP SFPNISADFL SDNSTSSSSS YSTSSDMDMG GATTNRKKRK  240
RKWKDFFERL MKQVVDKQED LQRKFLEAVE KREHERLVRE ESWRVQEIAR INREHEILAQ  300
ERSMSAAKDA AVMAFLQKLS EKQPNQPQPQ QVRQQMQLNN NNNQQQTPPP PPLPQPIQAL  360
VPTTSDTVKT DNGDQHMAPA SASGSASSSR WPKVEIEALI KLRTNLDSKY QENGPKGPLW  420
EEISAGMRRL GFNRNSKRCK EKWENINKYF KKVKESNKKR PEDSKTCPYF HQLDALYRER  480
NKFHSSSNNN NIASSSSASG LVKPDNSVPL MVQPEQQWPP APVTATVTAA VAAAQQPDQH  540
PQPSDQNFDD EEGTEEEYEE DEDEDEENEE EEGGEFELVP SSNNTNKTTN NL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235240RKKRKR
2235241RKKRKRK
3236241KKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0792830.0AC079283.4 Arabidopsis thaliana chromosome 1 BAC F7O12 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302034.10.0hypothetical protein CARUB_v10020016mg
SwissprotQ391171e-147TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLR0GGE90.0R0GGE9_9BRAS; Uncharacterized protein
STRINGscaffold_202643.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.10.0Trihelix family protein